PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.176780.1
Common NameCsa_3G730800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 478aa    MW: 52371.7 Da    PI: 6.8638
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.176780.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.23.4e-33171227259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh 
  Cucsa.176780.1 171 NDGYNWRKYGQKQVKGSENPRSYYKCTFPSCPTKKKVERSL-DGQITEIVYKGTHNHA 227
                     7****************************************.***************7 PP

2WRKY105.43e-33320377259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      Dgy+WrKYGqK+vkg+++prsYY+Cts gCpv+k++er+a+d ++v++tYeg+Hnhe
  Cucsa.176780.1 320 PDGYRWRKYGQKVVKGNPNPRSYYKCTSLGCPVRKHIERAANDMRAVITTYEGKHNHE 377
                     6********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-28157229IPR003657WRKY domain
PROSITE profilePS5081123.043165229IPR003657WRKY domain
SuperFamilySSF1182907.45E-25166229IPR003657WRKY domain
SMARTSM007745.8E-35170228IPR003657WRKY domain
PfamPF031063.8E-25171226IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.3E-36304379IPR003657WRKY domain
SuperFamilySSF1182902.22E-28311379IPR003657WRKY domain
PROSITE profilePS5081137.114314379IPR003657WRKY domain
SMARTSM007741.9E-37319378IPR003657WRKY domain
PfamPF031062.9E-25321377IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MSNINQTINT LAGGSSDNRT NNFAMEVPKF KSFQPPPFPM SPSSYLSSFS SGLSPTEILN  60
SPLLFSFGVF PSPTTGALNL RNDYEEVDQQ EMKGDVKNYS VSAYNPQTGS SVSSYFQSSS  120
SNLTLLQNPS GLSCDESGAK SEFVNTEMAA AESKQNSQLA IYNREQQKSE NDGYNWRKYG  180
QKQVKGSENP RSYYKCTFPS CPTKKKVERS LDGQITEIVY KGTHNHAKPQ PTRRSSNSGV  240
YDPSAAETGV LQEDCSVSVG EEEFEPNSPF SNSIEDNENE PEAKRWKGEN ENEGYCGGGS  300
RTVKEPRIVV QTTSEIDILP DGYRWRKYGQ KVVKGNPNPR SYYKCTSLGC PVRKHIERAA  360
NDMRAVITTY EGKHNHEVPA ARGSGGGGYN TINRPIPTNI PMALRPLSSV TSHSFPANFP  420
AAFRPGNLGM SETGTQASSF PFQTSHGVLP SFQVSGFGSA AKEEVRDDTY FINSFLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-36171380878Probable WRKY transcription factor 4
1wj2_A2e-36171380878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9840220.0GU984022.1 Cucumis sativus WRKY protein (WRKY23) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011651842.10.0PREDICTED: probable WRKY transcription factor 26 isoform X1
SwissprotQ8S8P51e-115WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A0A0LF620.0A0A0A0LF62_CUCSA; Uncharacterized protein
STRINGPOPTR_0016s13600.11e-131(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2476633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-108WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]